PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016474282.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 484aa    MW: 52694.2 Da    PI: 8.399
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016474282.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.5e-1765109147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r rWT+eE++++++a+k++G   W++I +++g ++t+ q++s+ qk+
   XP_016474282.1  65 RERWTEEEHKKFLEAIKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 109
                      78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.42E-1659113IPR009057Homeodomain-like
PROSITE profilePS5129421.89660114IPR017930Myb domain
TIGRFAMsTIGR015575.0E-1763112IPR006447Myb domain, plants
SMARTSM007171.4E-1364112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-1065105IPR009057Homeodomain-like
PfamPF002492.9E-1465108IPR001005SANT/Myb domain
CDDcd001678.10E-1167110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MASEEMVDQD QGGESGMDSI RSSRNGISSD VGASSTRSIQ LKEQVASADE YAPKARKPYT  60
ISKQRERWTE EEHKKFLEAI KLYGRAWRRI EEHVGTKTAV QIRSHAQKFF SKVVRESNNG  120
DASSVKPIEI PPPRPKRKPM HPYPRKLATP VKSGTLVPEK PTRSISPNMS MSEQKNQSPA  180
SVLSAHGSDA LGTVDSSKRN GSASPVSPAG GGNSDGFVLS EPPNFILQDS SSLAQACVKL  240
ELLPQEVNFV KEGSAETSST PCLKLFGKTV LVTESQRPRP TSGTCKIETD VNDEAALPTA  300
SLNLMPMKFT ASDSDCGSST LTMGIPPPFY YSPSQNENQW PTGCASATLL PWGSSCASVS  360
FPCIQVLNPI PIKGRPLFND NELEDKQNQK EGSSTGSNTE PVSAEMGGDK NMDIEAQSSQ  420
HPLEKARKEL SSRPSETPSL VRRASSTKRV KGFVPYKRCL AERGTNPSML SCEEREEQRT  480
RLCL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016474282.10.0PREDICTED: protein REVEILLE 1-like isoform X1
TrEMBLM1BXP30.0M1BXP3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000552630.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31852447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.12e-55MYB_related family protein